PDB entry 1uov

View 1uov on RCSB PDB site
Description: calcium binding domain c2b
Class: glycoprotein
Keywords: transmembrane, synapse, glycoprotein, lipoprotein
Deposited on 2003-09-24, released 2004-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.16371
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin I
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UOV (Start-7)
      • conflict (111)
      • conflict (130)
    • Uniprot P21707 (8-End)
    Domains in SCOPe 2.07: d1uova1, d1uova2
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uovA (A:)
    sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr
    lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns
    tgaelrhwsdmlanprrpiaqwhtlqveeevdamlavkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uovA (A:)
    leklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktt
    ikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrh
    wsdmlanprrpiaqwhtlqveeevdamlav