PDB entry 1uou

View 1uou on RCSB PDB site
Description: crystal structure of human thymidine phosphorylase in complex with a small molecule inhibitor
Class: transferase
Keywords: phosphorylase, transferase, glycosyltransferase, chemotaxis, angiogenesis
Deposited on 2003-09-23, released 2004-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.192
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidine phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uoua1, d1uoua2, d1uoua3
  • Heterogens: CMU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uouA (A:)
    gspgippapgdfsgegsqglpdpspepkqlpelirmkrdggrlseadirgfvaavvngsa
    qgaqigamlmairlrgmdleetsvltqalaqsgqqlewpeawrqqlvdkhstggvgdkvs
    lvlapalaacgckvpmisgrglghtggtldklesipgfnviqspeqmqvlldqagccivg
    qseqlvpadgilyaardvtatvdslplitasilskklveglsalvvdvkfggaavfpnqe
    qarelaktlvgvgaslglrvaaaltamdkplgrcvghaleveeallcmdgagppdlrdlv
    ttlggallwlsghagtqaqgaarvaaalddgsalgrfermlaaqgvdpglaralcsgspa
    errqllprareqeellapadgtvelvralplalvlhelgagrageplrlgvgaellvdvg
    qrlrrgtpwlrvhrdgpalsgpqsralqealvlsdrapfaaplpfaelvlppqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uouA (A:)
    pkqlpelirmkrdggrlseadirgfvaavvngsaqgaqigamlmairlrgmdleetsvlt
    qalaqsgqqlewpeawrqqlvdkhstggvgdkvslvlapalaacgckvpmisgrglghtg
    gtldklesipgfnviqspeqmqvlldqagccivgqseqlvpadgilyaardvtatvdslp
    litasilskklveglsalvvdvkfgavfpnqeqarelaktlvgvgaslglrvaaaltamd
    kplgrcvghaleveeallcmdgagppdlrdlvttlggallwlsghagtqaqgaarvaaal
    ddgsalgrfermlaaqgvdpglaralcsgspaerrqllprareqeellapadgtvelvra
    lplalvlhelgalrlgvgaellvdvgqrlrrgtpwlrvhrdgpalsgpqsralqealvls
    drapfaaplpfaelvlpp