PDB entry 1uot

View 1uot on RCSB PDB site
Description: human cd55 domains 3 & 4
Class: regulator of complement pathway
Keywords: regulator of complement pathway, immune system protein, complement decay accelerating factor, enteroviral receptor, bacterial receptor, ligand for cd97, complement pathway, alternative splicing, gpi-anchor
Deposited on 2003-09-23, released 2003-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.223
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: complement decay-accelerating factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uotp1, d1uotp2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uotP (P:)
    kscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
    reiycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpp
    pecrg