PDB entry 1uon

View 1uon on RCSB PDB site
Description: reovirus polymerase lambda-3 localized by electron cryomicroscopy of virions at 7.6-a resolution
Class: polymerase
Keywords: polymerase, reovirus, cryoem, core protein
Deposited on 2003-09-21, released 2003-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: EM
Resolution: 7.6 Å
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Minor core protein lambda 3
    Species: REOVIRUS [TaxId:10891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uona_
  • Chain 'B':
    Compound: 5'-r(*gp*gp*gp*gp*gp*)-3'
  • Chain 'C':
    Compound: 5'-r(*up*ap*gp*cp*cp*cp*cp*cp*)-3'
  • Heterogens: CH1, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uonA (A:)
    mssmiltqfgpfiesisgitdqsndvfedaakafsmftrsdvykaldeipfsddamlpip
    ptiytkpshdsyyyidalnrvrrktyqgpddvyvpncsivellephetltsygrlseaie
    nrakdgdsqariattygriaesqarqikaplekfvlallvaeaggslydpvlqkydeipd
    lshncplwcfreicrhisgplpdrapylylsagvfwlmsprmtsaippllsdlvnlailq
    qtagldpslvklgvqiclhaaasssyswfilktksifpqntlhsmyesleggycpnlewl
    eprsdykfmymgvmplsakyarsapsndkkarelgekyglssvvgelrkrtktyvkhdfa
    svryirdamactsgiflvrtptetvlqeytqspeikvpipqkdwtgpigeirilkdttss
    iarylyrtwylaaarmaaqprtwdplfqaimrsqyvtarggsgaalreslyainvslpdf
    kglpvkaatkifqaaqlanlpfshtsvailadtsmglrnqvqrrprsimplnvpqqqvsa
    phtltadyinyhmnlsptsgsaviekviplgvyassppnqsinidisacdasitwdffls
    vimaaihegvasssigkpfmgvpasivndesvvgvraarpisgmqnmiqhlsklykrgfs
    yrvndsfspgndfthmtttfpsgstatstehtannstmmetfltvwgpehtddpdvlrlm
    ksltiqrnyvcqgddglmiidgttagkvnsetiqndleliskygeefgwkydiaydgtae
    ylklyfifgcripnlsrhpivgkeranssaeepwpaildqimgvffngvhdglqwqrwir
    yswalccafsrqrtmigesvgylqypmwsfvywglplvkafgsdpwifswymptgdlgmy
    swislirplmtrwmvangyvtdrcstvfgnadyrrcfnelklyqgyymaqlprnpkksgr
    aasrevreqftqalsdylmqnpelksrvlrgrsewekygagiihnppslfdvphkwyqga
    qeaaiatreelaemdetlmrarrhsyssfsklleayllvkwrmcearepsvdlrlplcag
    idplnsdpflkmvsvgpmlqstrkyfaqtlfmaktvsgldvnaidsallrlrtlgadkka
    ltaqllmvglqeseadalagkimlqdvntvqlarvvnlavpdtwmsldfdsmfkhhvkll
    pkdgrhlntdipprmgwlrailrflgagmvmtatgvavdiyledihgggrslgqrfmtwm
    rqegrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uonA (A:)
    ssmiltqfgpfiesisgitdqsndvfedaakafsmftrsdvykaldeipfsddamlpipp
    tiytkpshdsyyyidalnrvrrktyqgpddvyvpncsivellephetltsygrlseaien
    rakdgdsqariattygriaesqarqikaplekfvlallvaeaggslydpvlqkydeipdl
    shncplwcfreicrhisgplpdrapylylsagvfwlmsprmtsaippllsdlvnlailqq
    tagldpslvklgvqiclhaaasssyswfilktksifpqntlhsmyesleggycpnlewle
    prsdykfmymgvmplsakyarsapsndkkarelgekyglssvvgelrkrtktyvkhdfas
    vryirdamactsgiflvrtptetvlqeytqspeikvpipqkdwtgpigeirilkdttssi
    arylyrtwylaaarmaaqprtwdplfqaimrsqyvtarggsgaalreslyainvslpdfk
    glpvkaatkifqaaqlanlpfshtsvailadtsmglrnqvqrrprsimplnvpqqqvsap
    htltadyinyhmnlsptsgsaviekviplgvyassppnqsinidisacdasitwdfflsv
    imaaihegvasssigkpfmgvpasivndesvvgvraarpisgmqnmiqhlsklykrgfsy
    rvndsfspgndfthmtttfpsgstatstehtannstmmetfltvwgpehtddpdvlrlmk
    sltiqrnyvcqgddglmiidgttagkvnsetiqndleliskygeefgwkydiaydgtaey
    lklyfifgcripnlsrhpivgkeranssaeepwpaildqimgvffngvhdglqwqrwiry
    swalccafsrqrtmigesvgylqypmwsfvywglplvkafgsdpwifswymptgdlgmys
    wislirplmtrwmvangyvtdrcstvfgnadyrrcfnelklyqgyymaqlprnpkksgra
    asrevreqftqalsdylmqnpelksrvlrgrsewekygagiihnppslfdvphkwyqgaq
    eaaiatreelaemdetlmrarrhsyssfsklleayllvkwrmcearepsvdlrlplcagi
    dplnsdpflkmvsvgpmlqstrkyfaqtlfmaktvsgldvnaidsallrlrtlgadkkal
    taqllmvglqeseadalagkimlqdvntvqlarvvnlavpdtwmsldfdsmfkhhvkllp
    kdgrhlntdipprmgwlrailrflgagmvmtatgvavdiyledihgggrslgqrfmtwmr
    qegr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.