PDB entry 1uom

View 1uom on RCSB PDB site
Description: the structure of estrogen receptor in complex with a selective and potent tetrahydroisochiolin ligand.
Class: nuclear protein
Keywords: selective estrogen receptor modulators, serm, receptor, transcription regulation, DNA-binding, nuclear protein, zinc-finger, steroid-binding, phosphorylation, polymorphism 3d-structure, alternative splicing
Deposited on 2003-04-11, released 2003-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.235
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UOM
      • engineered mutation (81)
      • engineered mutation (117)
    • Uniprot P03372
    Domains in SCOPe 2.07: d1uoma_
  • Heterogens: PTI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uomA (A:)
    mskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhmin
    wakrvpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksve
    gmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvl
    dkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydl
    llemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uomA (A:)
    alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
    fvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifd
    mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
    ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlplydlllemldah