PDB entry 1uol

View 1uol on RCSB PDB site
Description: crystal structure of the human p53 core domain mutant m133l/v203a/n239y/n268d at 1.9 a resolution.
Class: DNA-binding protein
Keywords: p53, DNA-binding domain, tumor suppressor, second-site suppressor mutation, superstable mutant, apoptosis, transcription regulation
Deposited on 2003-09-19, released 2003-10-16
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637
      • engineered mutation (39)
      • engineered mutation (109)
      • engineered mutation (145)
      • engineered mutation (174)
    Domains in SCOP 1.73: d1uola_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637
      • engineered mutation (39)
      • engineered mutation (109)
      • engineered mutation (145)
      • engineered mutation (174)
    Domains in SCOP 1.73: d1uolb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uolA (A:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
    hsvvvpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr
    vcacpgrdrrteeenlrkkgephhelppgstkralpnnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uolA (A:)
    svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
    rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
    vvvpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
    acpgrdrrteeenlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uolB (B:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
    hsvvvpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr
    vcacpgrdrrteeenlrkkgephhelppgstkralpnnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uolB (B:)
    svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
    rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
    vvvpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
    acpgrdrrteeenlr