PDB entry 1uok

View 1uok on RCSB PDB site
Description: crystal structure of b. cereus oligo-1,6-glucosidase
Deposited on 1998-07-28, released 1999-02-16
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uok_ (-)
    mekqwwkesvvyqiyprsfmdsngdgigdlrgiiskldylkelgidviwlspvyespndd
    ngydisdyckimnefgtmedwdellhemhernmklmmdlvvnhtsdehnwfiesrkskdn
    kyrdyyiwrpgkegkepnnwgaafsgsawqydemtdeyylhlfskkqpdlnwdnekvrqd
    vyemmkfwlekgidgfrmdvinfiskeeglptveteeegyvsghkhfmngpnihkylhem
    neevlshydimtvgempgvtteeaklytgeerkelqmvfqfehmdldsgeggkwdvkpcs
    lltlkenltkwqkalehtgwnslywnnhdqprvvsrfgndgmyriesakmlatvlhmmkg
    tpyiyqgeeigmtnvrfesideyrdietlnmykekvmergediekvmqsiyikgrdnart
    pmqwddqnhagfttgepwitvnpnykeinvkqaiqnkdsifyyykklielrknneivvyg
    sydlilennpsifayvrtygvekllvianftaeecifelpedisysevellihnydveng
    pienitlrpyeamvfklk