PDB entry 1uok

View 1uok on RCSB PDB site
Description: crystal structure of b. cereus oligo-1,6-glucosidase
Class: glucosidase
Keywords: glucosidase, sugar degradation, hydrolase, tim-barrel glycosidase
Deposited on 1998-07-28, released 1999-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oligo-1,6-glucosidase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uoka1, d1uoka2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uokA (A:)
    mekqwwkesvvyqiyprsfmdsngdgigdlrgiiskldylkelgidviwlspvyespndd
    ngydisdyckimnefgtmedwdellhemhernmklmmdlvvnhtsdehnwfiesrkskdn
    kyrdyyiwrpgkegkepnnwgaafsgsawqydemtdeyylhlfskkqpdlnwdnekvrqd
    vyemmkfwlekgidgfrmdvinfiskeeglptveteeegyvsghkhfmngpnihkylhem
    neevlshydimtvgempgvtteeaklytgeerkelqmvfqfehmdldsgeggkwdvkpcs
    lltlkenltkwqkalehtgwnslywnnhdqprvvsrfgndgmyriesakmlatvlhmmkg
    tpyiyqgeeigmtnvrfesideyrdietlnmykekvmergediekvmqsiyikgrdnart
    pmqwddqnhagfttgepwitvnpnykeinvkqaiqnkdsifyyykklielrknneivvyg
    sydlilennpsifayvrtygvekllvianftaeecifelpedisysevellihnydveng
    pienitlrpyeamvfklk