PDB entry 1uog

View 1uog on RCSB PDB site
Description: deacetoxycephalosporin c synthase complexed with deacetoxycephalosporin c
Class: oxidoreductase
Keywords: oxidoreductase, antibiotic biosynthesis
Deposited on 2003-09-17, released 2004-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.206
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deacetoxycephalosporin c synthetase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uoga_
  • Heterogens: P1C, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uogA (A:)
    mdttvptfslaelqqglhqdefrrclrdkglfyltdcgltdtelksakdlvidffehgse
    aekravtspvptmrrgftglesestaqitntgsysdysmcysmgtadnlfpsgdferiwt
    qyfdrqytasravarevlratgtepdggveafldcepllrfryfpqvpehrsaeeqplrm
    aphydlsmvtliqqtpcangfvslqaevggaftdlpyrpdavlvfcgaiatlvtggqvka
    prhhvaaprrdqiagssrtssvfflrpnadftfsvplarecgfdvsldgetatfqdwigg
    nyvnirrtska
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uogA (A:)
    dttvptfslaelqqglhqdefrrclrdkglfyltdcgltdtelksakdlvidffehgsea
    ekravtspvptmrrgftglsmcysmgtadnlfpsgdferiwtqyfdrqytasravarevl
    ratgtepdggveafldcepllrfryfaphydlsmvtliqqtlqaevggaftdlpyrpdav
    lvfcgaiatlvtggqvkaprhhvatssvfflrpnadftfsvplarecgfdvsldgetatf
    qdwiggnyvnirrtsk