PDB entry 1uoe

View 1uoe on RCSB PDB site
Description: crystal structure of the dihydroxyacetone kinase from e. coli in complex with glyceraldehyde
Class: transferase
Keywords: kinase, transferase
Deposited on 2003-09-16, released 2004-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroxyacetone kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76015 (215-365)
      • conflict (19)
      • conflict (242)
    Domains in SCOPe 2.07: d1uoea_
  • Chain 'B':
    Compound: dihydroxyacetone kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76015 (215-365)
      • conflict (19)
      • conflict (242)
    Domains in SCOPe 2.07: d1uoeb_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uoeA (A:)
    mpyrncwskimkklindvqqvldeqlaglakahpsltlhqdpvyvtradapvagkvalls
    gggsghepmhcgyigqgmlsgacpgeiftsptpdkifecamqvdggegvlliiknytgdi
    lnfetatellhdsgvkvttvvidddvavkdslytagrrgvantvlieklvgaaaergdsl
    dacaelgrklnnqghsigialgactvpaagkpsftladnemefgvgihgepgidrrpfss
    ldntvdemfdtllvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatpl
    selygvynrlttrcqqagltiernligayctsldmtgfsitllkvddetlalwdapvhtp
    alnwgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uoeA (A:)
    qvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhcgyigqgml
    sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt
    vvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrklnnqghsigi
    algacladnemefgvgihgepgidrrpfssldntvdemfdtllvngsyhrtlrfwdyqqg
    swqeeqqtkqplqsgdrvialvnnlgatplselygvynrlttrcqqagltiernligayc
    tsldmtgfsitllkvddetlalwdapvhtpalnwgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uoeB (B:)
    mpyrncwskimkklindvqqvldeqlaglakahpsltlhqdpvyvtradapvagkvalls
    gggsghepmhcgyigqgmlsgacpgeiftsptpdkifecamqvdggegvlliiknytgdi
    lnfetatellhdsgvkvttvvidddvavkdslytagrrgvantvlieklvgaaaergdsl
    dacaelgrklnnqghsigialgactvpaagkpsftladnemefgvgihgepgidrrpfss
    ldntvdemfdtllvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatpl
    selygvynrlttrcqqagltiernligayctsldmtgfsitllkvddetlalwdapvhtp
    alnwgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uoeB (B:)
    qvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhcgyigqgml
    sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt
    vvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrklnnqghsigi
    algacladnemefgvgihgepgidrrpfssldntvdemfdtllvngsyhrtlrfwdyqqg
    swqeeqqtkqplqsgdrvialvnnlgatplselygvynrlttrcqqagltiernligayc
    tsldmtgfsitllkvddetlalwdapvhtpalnwgk