PDB entry 1uod

View 1uod on RCSB PDB site
Description: crystal structure of the dihydroxyacetone kinase from e. coli in complex with dihydroxyacetone-phosphate
Class: transferase
Keywords: transferase, kinase
Deposited on 2003-09-16, released 2004-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroxyacetone kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uoda_
  • Chain 'B':
    Compound: dihydroxyacetone kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uodb_
  • Heterogens: G3H, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uodA (A:)
    mpyrncwskimkklindvqdvldeqlaglakahpsltlhqdpvyvtradapvagkvalls
    gggsghepmhcgyigqgmlsgacpgeiftsptpdkifecamqvdggegvlliiknytgdi
    lnfetatellhdsgvkvttvvidddvavkdslytagrrgvantvlieklvgaaaergdsl
    dacaelgrklnnqghsigialgactvpaagkpsftladnemefgvgihgepgidrrpfss
    ldqtvdemfdtllvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatpl
    selygvynrlttrcqqagltiernligayctsldmtgfsitllkvddetlalwdapvhtp
    alnwgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uodA (A:)
    dvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhcgyigqgml
    sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt
    vvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrklnnqghsigi
    algacladnemefgvgihgepgidrrpfssldqtvdemfdtllvngsyhrtlrfwdyqqg
    swqeeqqtkqplqsgdrvialvnnlgatplselygvynrlttrcqqagltiernligayc
    tsldmtgfsitllkvddetlalwdapvhtpalnwgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uodB (B:)
    mpyrncwskimkklindvqdvldeqlaglakahpsltlhqdpvyvtradapvagkvalls
    gggsghepmhcgyigqgmlsgacpgeiftsptpdkifecamqvdggegvlliiknytgdi
    lnfetatellhdsgvkvttvvidddvavkdslytagrrgvantvlieklvgaaaergdsl
    dacaelgrklnnqghsigialgactvpaagkpsftladnemefgvgihgepgidrrpfss
    ldqtvdemfdtllvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatpl
    selygvynrlttrcqqagltiernligayctsldmtgfsitllkvddetlalwdapvhtp
    alnwgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uodB (B:)
    dvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhcgyigqgml
    sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt
    vvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrklnnqghsigi
    algacladnemefgvgihgepgidrrpfssldqtvdemfdtllvngsyhrtlrfwdyqqg
    swqeeqqtkqplqsgdrvialvnnlgatplselygvynrlttrcqqagltiernligayc
    tsldmtgfsitllkvddetlalwdapvhtpalnwgk