PDB entry 1unq

View 1unq on RCSB PDB site
Description: High resolution crystal structure of the Pleckstrin Homology Domain Of Protein Kinase B/Akt Bound To Ins(1,3,4,5)-Tetrakisphophate
Class: transferase
Keywords: transferase, pleckstrin homology domain, pkb, akt, phosphoinositide, serine/threonine-protein kinase, ATP-binding, phosphorylation, nuclear protein
Deposited on 2003-09-12, released 2004-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 0.98 Å
R-factor: N/A
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rac-alpha serine/threonine kinase
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 1UNQ (Start-0)
  • Uniprot P31749 (1-End)
  Domains in SCOPe 2.08: d1unqa_
• Heterogens: 4IP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1unqA (A:)
  smsdvaivkegwlhkrgeyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaq
  cqlmkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeeeemd
  frsg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1unqA (A:)
  smsdvaivkegwlhkrgeyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaq
  cqlmkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeeee