PDB entry 1unq

View 1unq on RCSB PDB site
Description: high resolution crystal structure of the pleckstrin homology domain of protein kinase b/akt bound to ins (1,3,4,5)-tetrakisphophate
Class: transferase
Keywords: transferase, pleckstrin homology domain, pkb, akt, phosphoinositide, serine/threonine-protein kinase, ATP-binding, phosphorylation, nuclear protein
Deposited on 2003-09-12, released 2004-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.98 Å
R-factor: 0.1513
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rac-alpha serine/threonine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UNQ (Start-0)
    • Uniprot P31749 (1-End)
    Domains in SCOPe 2.07: d1unqa_
  • Heterogens: 4IP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1unqA (A:)
    smsdvaivkegwlhkrgeyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaq
    cqlmkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeeeemd
    frsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1unqA (A:)
    smsdvaivkegwlhkrgeyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaq
    cqlmkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeeee