PDB entry 1unl

View 1unl on RCSB PDB site
Description: structural mechanism for the inhibition of cd5-p25 from the roscovitine, aloisine and indirubin.
Deposited on 2003-09-10, released 2004-11-10
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-10, with a file datestamp of 2004-11-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2159
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1unla_
  • Chain 'B':
    Domains in SCOP 1.71: d1unlb_
  • Chain 'D':
    Domains in SCOP 1.71: d1unld_
  • Chain 'E':
    Domains in SCOP 1.71: d1unle_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1unlA (A:)
    mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
    knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
    nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys
    tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
    mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1unlB (B:)
    mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
    knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
    nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys
    tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
    mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1unlD (D:)
    qpppaqppappasqlsgsqtggsssvkkaphpavtsagtpkrvivqastsellrclgefl
    crrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflymlcrdvissevgsd
    helqavlltclylsysymgneisyplkpflvesckeafwdrclsvinlmsskmlqinadp
    hyftqvfsdlknesgqedkkrlllgldr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1unlD (D:)
    qastsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvfl
    ymlcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsv
    inlmsskmlqinadphyftqvfsdlknesg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1unlE (E:)
    qpppaqppappasqlsgsqtggsssvkkaphpavtsagtpkrvivqastsellrclgefl
    crrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflymlcrdvissevgsd
    helqavlltclylsysymgneisyplkpflvesckeafwdrclsvinlmsskmlqinadp
    hyftqvfsdlknesgqedkkrlllgldr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1unlE (E:)
    qastsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvfl
    ymlcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsv
    inlmsskmlqinadphyftqvfsdlknesg