PDB entry 1unk

View 1unk on RCSB PDB site
Description: structure of colicin e7 immunity protein
Class: immunity protein
Keywords: immunity protein, dimeric structure, RNAse active site
Deposited on 1996-06-21, released 1998-01-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin e7
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1unka_
  • Chain 'B':
    Compound: colicin e7
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1unkb_
  • Chain 'C':
    Compound: colicin e7
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1unkc_
  • Chain 'D':
    Compound: colicin e7
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1unkd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1unkA (A:)
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1unkB (B:)
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1unkC (C:)
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1unkD (D:)
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg