PDB entry 1unf

View 1unf on RCSB PDB site
Description: the crystal structure of the eukaryotic fesod from vigna unguiculata suggests a new enzymatic mechanism
Deposited on 2003-09-10, released 2004-10-27
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-27, with a file datestamp of 2004-10-27.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.15016
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1unfX (X:)
    nvaginllfkegpkvnakfelkpppyplnglepvmsqqtlefhwgkhhrtyvenlkkqvv
    gteldgksleeiivtaynkgdilpafnnaaqvwnhdffwecmkpggggkpsgellelier
    dfgsfekfldefkaaaatqfgsgwawlaykaskldgenaanppsadednklvvikspnav
    nplvwggyyplltidvwehayyldfqnrrpdyisvfmdklvswdavssrleqakalsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1unfX (X:)
    kvnakfelkpppyplnglepvmsqqtlefhwgkhhrtyvenlkkqvteldgksleeiivt
    aynkgdilpafnnaaqvwnhdffwecmkpggggkpsgellelierdfgsfekfldefkaa
    aatqfgsgwawlaykaskldadednklvvikspnavnplvwggyyplltidvwehayyld
    fqnrrpdyisvfmdklvswdavssrleqakalsa