PDB entry 1und

View 1und on RCSB PDB site
Description: solution structure of the human advillin c-terminal headpiece subdomain
Class: actin binding
Keywords: actin binding, f-actin binding, cytoskeleton, headpiece subdomain
Deposited on 2003-09-09, released 2004-07-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: advillin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UND
    • Uniprot O75366 (0-35)
    Domains in SCOPe 2.03: d1unda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1undA (A:)
    ylseqdfvsvfgitrgqfaalpgwkqlqmkkekglf