PDB entry 1und

View 1und on RCSB PDB site
Description: solution structure of the human advillin c-terminal headpiece subdomain
Deposited on 2003-09-09, released 2004-07-15
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-15, with a file datestamp of 2004-07-15.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1unda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1undA (A:)
    ylseqdfvsvfgitrgqfaalpgwkqlqmkkekglf