PDB entry 1una

View 1una on RCSB PDB site
Description: unassembled virus coat protein dimer, bacteriophage RNA-binding dimer
Class: Viral protein
Keywords: UNASSEMBLED VIRUS COAT PROTEIN DIMER, BACTERIOPHAGE, RNA-BINDING DIMER, TRANSLATIONAL REPRESSOR, Viral protein
Deposited on 1996-04-25, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.204
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ga unassembled coat protein dimer
    Species: Enterobacteria phage BZ13 [TaxId:12018]
    Gene: GA COAT GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07234 (0-128)
      • conflict (3)
      • conflict (57)
      • conflict (77)
      • conflict (107)
    Domains in SCOPe 2.07: d1unaa_
  • Chain 'B':
    Compound: ga unassembled coat protein dimer
    Species: Enterobacteria phage BZ13 [TaxId:12018]
    Gene: GA COAT GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07234 (0-128)
      • conflict (3)
      • conflict (57)
      • conflict (77)
      • conflict (107)
    Domains in SCOPe 2.07: d1unab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1unaA (A:)
    atlhsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
    levpkivtqvvngvelpvsawkayasidltipifaatddvtvisksltglfkvgnpiaea
    issqsgfya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1unaA (A:)
    atlhsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
    levpkivelpvsawkayasidltipifaatddvtvisksltglfkvgnpiaeaissqsgf
    ya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1unaB (B:)
    atlhsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
    levpkivtqvvngvelpvsawkayasidltipifaatddvtvisksltglfkvgnpiaea
    issqsgfya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1unaB (B:)
    atlhsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
    levpkivelpvsawkayasidltipifaatddvtvisksltglfkvgnpiaeaissqsgf
    ya