PDB entry 1un8

View 1un8 on RCSB PDB site
Description: crystal structure of the dihydroxyacetone kinase of c. freundii (native form)
Deposited on 2003-09-08, released 2003-10-10
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19992
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1un8A (A:)
    msqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg
    hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl
    aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergynlatvlreaq
    yaasntfslgvalsschlpqetdaaprhhpghaelgmgihgepgasvidtqnsaqvvnlm
    vdkllaalpetgrlavminnlggvsvaemaiitrelassplhsridwligpaslvtaldm
    kgfsltaivleesiekalltevetsnwptpvppreitcvvsshasarvefqpsanalvag
    ivelvtatlsdlethlnaldakvgdgdtgstfaaaareiasllhrqqlplnnlatlfali
    gerltvvmggssgvlmsifftaagqkleqganvvealntglaqmkfyggadegdrtmida
    lqpaltsllaqpknlqaafdaaqagaertclsskanagrasylssesllgnmdpgaqrla
    mvfkalaeselg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1un8A (A:)
    msqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg
    hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl
    aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergynlatvlreaq
    yaasntfslgvalsschlpqetdaaprhhpghaelgmgihgepgasvidtqnsaqvvnlm
    vdkllaalpetgrlavminnlggvsvaemaiitrelassplhsridwligpaslvtaldm
    kgfsltaivleesiekalltevetsnwptpvppreitcvvsshasarvefqpsanalvag
    ivelvtatlsdlethlnaldakvgdgdtgstfaaaareiasllhrqqlplnnlatlfali
    gerltvvmggssgvlmsifftaagqkleqganvvealntglaqmkfyggadegdrtmida
    lqpaltsllaqpknlqaafdaaqagaertclsskanaesllgnmdpgaqrlamvfkalae
    se
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1un8B (B:)
    msqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg
    hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl
    aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergynlatvlreaq
    yaasntfslgvalsschlpqetdaaprhhpghaelgmgihgepgasvidtqnsaqvvnlm
    vdkllaalpetgrlavminnlggvsvaemaiitrelassplhsridwligpaslvtaldm
    kgfsltaivleesiekalltevetsnwptpvppreitcvvsshasarvefqpsanalvag
    ivelvtatlsdlethlnaldakvgdgdtgstfaaaareiasllhrqqlplnnlatlfali
    gerltvvmggssgvlmsifftaagqkleqganvvealntglaqmkfyggadegdrtmida
    lqpaltsllaqpknlqaafdaaqagaertclsskanagrasylssesllgnmdpgaqrla
    mvfkalaeselg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1un8B (B:)
    msqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg
    hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl
    aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergynlatvlreaq
    yaasntfslgvalsschlpqetdaaprhhpghaelgmgihgepgasvidtqnsaqvvnlm
    vdkllaalpetgrlavminnlggvsvaemaiitrelassplhsridwligpaslvtaldm
    kgfsltaivleesiekalltevetsnwptpvppreitcvvsshasarvefqpsanalvag
    ivelvtatlsdlethlnaldakvgdgdtgstfaaaareiasllhrqqlplnnlatlfali
    gerltvvmggssgvlmsifftaagqkleqganvvealntglaqmkfyggadegdrtmida
    lqpaltsllaqpknlqaafdaaqagaertclsskanaesllgnmdpgaqrlamvfkalae
    se