PDB entry 1un7

View 1un7 on RCSB PDB site
Description: the 3-d structure of the n-acetylglucosamine-6-phosphate deacetylase, naga, from bacillus subtilis: a member of the urease superfamily
Deposited on 2003-09-04, released 2003-10-16
The last revision was dated 2007-12-04, with a file datestamp of 2007-11-30.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.203
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylglucosamine-6-phosphate deacetylase
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: N-acetylglucosamine-6-phosphate deacetylase
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GLP, FE, 2PE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1un7A (A:)
    nagamaesllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvll
    pgmidihihggygadtmdasfstldimssrlpeegttsflattitqehgnisqalvnare
    wkaaeessllgaellgihlegpfvspkragaqpkewirpsdvelfkkwqqeagglikivt
    lapeedqhfelirhlkdesiiasmghtdadsallsdaakagashmthlynamspfhhrep
    gvigtalahdgfvteliadgihshplaaklaflakgssklilitdsmrakglkdgvyefg
    gqsvtvrgrtallsdgtlagsilkmnegarhmreftncswtdianitsenaakqlgifdr
    kgsvtvgkdadlvivssdcevilticrgniafiskeadqi
    

    Sequence, based on observed residues (ATOM records):
    >1un7A (A:)
    esllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvllpgmidi
    hihggygadtmdasfstldimssrlpeegttsflattitqehgnisqalvnarewkaaee
    ssllgaellgihlegpfvspkragaqpkewirpsdvelfkkwqqeagglikivtlapeed
    qhfelirhlkdesiiasmghtdadsallsdaakagashmthlynamspfhhrepgvigta
    lahdgfvteliadgihshplaaklaflakgssklilitdsmrakglkdgvyefggqsvtv
    rgrtallsdgtlagsilkmnegarhmreftncswtdianitsenaakqlgifdrkgsvtv
    gkdadlvivssdcevilticrgniafiskead
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1un7B (B:)
    nagamaesllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvll
    pgmidihihggygadtmdasfstldimssrlpeegttsflattitqehgnisqalvnare
    wkaaeessllgaellgihlegpfvspkragaqpkewirpsdvelfkkwqqeagglikivt
    lapeedqhfelirhlkdesiiasmghtdadsallsdaakagashmthlynamspfhhrep
    gvigtalahdgfvteliadgihshplaaklaflakgssklilitdsmrakglkdgvyefg
    gqsvtvrgrtallsdgtlagsilkmnegarhmreftncswtdianitsenaakqlgifdr
    kgsvtvgkdadlvivssdcevilticrgniafiskeadqi
    

    Sequence, based on observed residues (ATOM records):
    >1un7B (B:)
    esllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvllpgmidi
    hihggygadtmdasfstldimssrlpeegttsflattitqehgnisqalvnarewkaaee
    ssllgaellgihlegpfvspkragaqpkewirpsdvelfkkwqqeagglikivtlapeed
    qhfelirhlkdesiiasmghtdadsallsdaakagashmthlynamspfhhrepgvigta
    lahdgfvteliadgihshplaaklaflakgssklilitdsmrakglkdgvyefggqsvtv
    rgrtallsdgtlagsilkmnegarhmreftncswtdianitsenaakqlgifdrkgsvtv
    gkdadlvivssdcevilticrgniafiskead