PDB entry 1un6
View 1un6 on RCSB PDB site
Description: the crystal structure of a zinc finger - RNA complex reveals two modes of molecular recognition
Class: RNA-binding protein/RNA
Keywords: RNA-binding protein/RNA, complex(zinc finger/RNA), tfiiia, 5s ribosomal RNA, zinc finger, RNA-protein complex, x. laevis, transcription regulation, RNA-binding, DNA-binding, nuclear protein
Deposited on
2003-09-04, released
2003-11-20
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.216
AEROSPACI score: 0.18
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'B':
Compound: transcription factor iiia
Species: Xenopus laevis [TaxId:8355]
Database cross-references and differences (RAF-indexed):
- PDB 1UN6 (Start-11)
- Uniprot P03001 (1-86)
Domains in SCOPe 2.03: d1un6b1, d1un6b2, d1un6b3 - Chain 'C':
Compound: transcription factor iiia
Species: Xenopus laevis [TaxId:8355]
Database cross-references and differences (RAF-indexed):
- PDB 1UN6 (Start-11)
- Uniprot P03001 (1-86)
Domains in SCOPe 2.03: d1un6c1, d1un6c2, d1un6c3 - Chain 'D':
Compound: transcription factor iiia
Species: Xenopus laevis [TaxId:8355]
Database cross-references and differences (RAF-indexed):
- PDB 1UN6
- Uniprot P03001 (Start-86)
Domains in SCOPe 2.03: d1un6d1, d1un6d2 - Chain 'E':
Compound: 5S ribosomal RNA
Species: Xenopus laevis [TaxId:8355]
- Chain 'F':
Compound: 5S ribosomal RNA
Species: Xenopus laevis [TaxId:8355]
- Heterogens: ZN, MG, HOH
PDB Chain Sequences:
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1un6B (B:)
myvchfencgkafkkhnqlkvhqfshtqqlpyecphegcdkrfslpsrlkrhekvhagyp
ckkddscsfvgktwtlylkhvaechqd
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1un6C (C:)
myvchfencgkafkkhnqlkvhqfshtqqlpyecphegcdkrfslpsrlkrhekvhagyp
ckkddscsfvgktwtlylkhvaechqd
- Chain 'D':
Sequence, based on SEQRES records: (download)
>1un6D (D:)
myvchfencgkafkkhnqlkvhqfshtqqlpyecphegcdkrfslpsrlkrhekvhagyp
ckkddscsfvgktwtlylkhvaechqd
Sequence, based on observed residues (ATOM records): (download)
>1un6D (D:)
lpyecphegcdkrfslpsrlkrhekvhagypckkddscsfvgktwtlylkhvaechqd
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.