PDB entry 1un6

View 1un6 on RCSB PDB site
Description: the crystal structure of a zinc finger - RNA complex reveals two modes of molecular recognition
Class: RNA-binding protein/RNA
Keywords: RNA-binding protein/RNA, complex(zinc finger/RNA), tfiiia, 5s ribosomal RNA, zinc finger, RNA-protein complex, x. laevis, transcription regulation, RNA-binding, DNA-binding, nuclear protein
Deposited on 2003-09-04, released 2003-11-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.216
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: transcription factor iiia
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UN6 (Start-11)
    • Uniprot P03001 (1-86)
    Domains in SCOPe 2.03: d1un6b1, d1un6b2, d1un6b3
  • Chain 'C':
    Compound: transcription factor iiia
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UN6 (Start-11)
    • Uniprot P03001 (1-86)
    Domains in SCOPe 2.03: d1un6c1, d1un6c2, d1un6c3
  • Chain 'D':
    Compound: transcription factor iiia
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UN6
    • Uniprot P03001 (Start-86)
    Domains in SCOPe 2.03: d1un6d1, d1un6d2
  • Chain 'E':
    Compound: 5S ribosomal RNA
    Species: Xenopus laevis [TaxId:8355]
  • Chain 'F':
    Compound: 5S ribosomal RNA
    Species: Xenopus laevis [TaxId:8355]
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1un6B (B:)
    myvchfencgkafkkhnqlkvhqfshtqqlpyecphegcdkrfslpsrlkrhekvhagyp
    ckkddscsfvgktwtlylkhvaechqd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1un6C (C:)
    myvchfencgkafkkhnqlkvhqfshtqqlpyecphegcdkrfslpsrlkrhekvhagyp
    ckkddscsfvgktwtlylkhvaechqd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1un6D (D:)
    myvchfencgkafkkhnqlkvhqfshtqqlpyecphegcdkrfslpsrlkrhekvhagyp
    ckkddscsfvgktwtlylkhvaechqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1un6D (D:)
    lpyecphegcdkrfslpsrlkrhekvhagypckkddscsfvgktwtlylkhvaechqd
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.