PDB entry 1un6

View 1un6 on RCSB PDB site
Description: the crystal structure of a zinc finger- RNA complex reveals two modes of molecular recognition
Class: complex(zinc finger/RNA)
Keywords: tfiiia, 5s ribosomal RNA, zinc finger, RNA-protein complex, x. laevis, transcription regulation, RNA-binding, DNA-binding, nuclear protein
Deposited on 2003-09-04, released 2003-11-20
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.216
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: transcription factor iiia
  Species: Xenopus laevis
  Database cross-references and differences (RAF-indexed):
  • PDB 1UN6 (Start-11)
  • Uniprot P03001 (1-86)
  Domains in SCOP 1.73: d1un6b1, d1un6b2, d1un6b3
• Chain 'C':
  Compound: transcription factor iiia
  Species: Xenopus laevis
  Database cross-references and differences (RAF-indexed):
  • PDB 1UN6 (Start-11)
  • Uniprot P03001 (1-86)
  Domains in SCOP 1.73: d1un6c1, d1un6c2, d1un6c3
• Chain 'D':
  Compound: transcription factor iiia
  Species: Xenopus laevis
  Database cross-references and differences (RAF-indexed):
  • PDB 1UN6
  • Uniprot P03001 (Start-86)
  Domains in SCOP 1.73: d1un6d1, d1un6d2
• Chain 'E':
  Compound: 5S ribosomal RNA
  Species: Xenopus laevis
  
• Chain 'F':
  Compound: 5S ribosomal RNA
  Species: Xenopus laevis
  
• Heterogens: ZN, MG, HOH

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1un6B (B:)
  myvchfencgkafkkhnqlkvhqfshtqqlpyecphegcdkrfslpsrlkrhekvhagyp
  ckkddscsfvgktwtlylkhvaechqd
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1un6C (C:)
  myvchfencgkafkkhnqlkvhqfshtqqlpyecphegcdkrfslpsrlkrhekvhagyp
  ckkddscsfvgktwtlylkhvaechqd
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >1un6D (D:)
  myvchfencgkafkkhnqlkvhqfshtqqlpyecphegcdkrfslpsrlkrhekvhagyp
  ckkddscsfvgktwtlylkhvaechqd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1un6D (D:)
  lpyecphegcdkrfslpsrlkrhekvhagypckkddscsfvgktwtlylkhvaechqd
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.