PDB entry 1un5

View 1un5 on RCSB PDB site
Description: arh-II, an angiogenin/RNAse a chimera
Class: hydrolase
Keywords: hydrolase, pancreatic ribonuclease, angiogenesis, angiogenin, chimera, hybrid, homolog scanning mutagenesis
Deposited on 2003-09-04, released 2004-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.208
AEROSPACI score: -1.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1un5a_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1un5A (A:)
    mqdnsrythfltqhydakpqgrddrycesimrrrgltsdrckpintfihgnkrsikaice
    nkngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqs
    ifrrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1un5A (A:)
    nsrythfltqhydakpqgrddrycesimrrrgltsdrckpintfihgnkrsikaicenkn
    gnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsifr
    r