PDB entry 1un3

View 1un3 on RCSB PDB site
Description: crystal structure of human angiogenin variant t44d
Class: hydrolase
Keywords: ribonuclease, hydrolase, nuclease, endonuclease, angiogenesis, pyrrolidone carboxylic acid
Deposited on 2003-09-04, released 2004-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.2
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03950
      • engineered mutation (43)
    Domains in SCOPe 2.06: d1un3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1un3A (A:)
    ednsrythfltqhydakpqgrddrycesimrrrgltspckdindfihgnkrsikaicenk
    ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif
    rrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1un3A (A:)
    nsrythfltqhydakpqgrddrycesimrrrgltspckdindfihgnkrsikaicenkng
    nphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldq