PDB entry 1un2

View 1un2 on RCSB PDB site
Description: crystal structure of circularly permuted cpdsba_q100t99 preserved global fold and local structural adjustments
Class: oxidoreductase
Keywords: disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin, redox protein, disulfide bond formation, circular permutation
Deposited on 2003-09-03, released 2003-09-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: -3.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thiol-disulfide interchange protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991 (Start-193)
    • PDB 1UN2 (193-193)
    Domains in SCOPe 2.06: d1un2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1un2A (A:)
    qtirsasdirdvfinagikgeeydaawnsfvvkslvaqqekaaadvqlrgvpamfvngky
    qlnpqgmdtsnmdvfvqqyadtvkylsekkgggtgaqyedgkqyttlekpvagapqvlef
    fsffcphcyqfeevlhisdnvkkklpegvkmtkyhvnfmggdlgkdltqawavamalgve
    dkvtvplfegvqktlik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1un2A (A:)
    qtirsasdirdvfinagikgeeydaawnsfvvkslvaqqekaaadvqlrgvpamfvngky
    qlnpqgmdtsnmdvfvqqyadtvkylseyedgkqyttlekpvagapqvleffsffcphcy
    qfeevlhisdnvkkklpegvkmtkyhvnfmggdlgkdltqawavamalgvedkvtvplfe
    gvqktl