PDB entry 1un1

View 1un1 on RCSB PDB site
Description: xyloglucan endotransglycosylase native structure.
Class: transferase
Keywords: glycoside hydrolase, xet, xth, xeh, transglycosylation, xyloglucan, transferase, glycosyltransferase
Deposited on 2003-09-03, released 2004-03-18
The last revision prior to the SCOP 1.73 freeze date was dated 2004-04-08, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.20763
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xyloglucan endotransglycosylase
    Species: Populus tremula
    Database cross-references and differences (RAF-indexed):
    • PDB 1UN1
    • Uniprot Q8GZD5 (Start-277)
    Domains in SCOP 1.73: d1un1a_
  • Chain 'B':
    Compound: xyloglucan endotransglycosylase
    Species: Populus tremula
    Database cross-references and differences (RAF-indexed):
    • PDB 1UN1
    • Uniprot Q8GZD5 (Start-277)
    Domains in SCOP 1.73: d1un1b_
  • Heterogens: AU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1un1A (A:)
    xetaafaalrkpvdvafgrnyvptwafdhikyfnggneiqlhldkytgtgfqskgsylfg
    hfsmqmklvpgdsagtvtafylssqnsehdeidfeflgnrtgqpyilqtnvftggkgdre
    qriylwfdptkefhyysvlwnmymivflvddvpirvfknckdlgvkfpfnqpmkiysslw
    naddwatrgglektdwskapfiasyrsfhidgceasveakfcatqgarwwdqkefqdlda
    fqyrrlswvrqkytiynyctdrsrypsmppeckrdrdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1un1A (A:)
    pvdvafgrnyvptwafdhikyfnggneiqlhldkytgtgfqskgsylfghfsmqmklvpg
    dsagtvtafylssqnsehdeidfeflgnrtgqpyilqtnvftggkgdreqriylwfdptk
    efhyysvlwnmymivflvddvpirvfknckdlgvkfpfnqpmkiysslwnaddwatrggl
    ektdwskapfiasyrsfhidgceasveakfcatqgarwwdqkefqdldafqyrrlswvrq
    kytiynyctdrsrypsmppeckrdrdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1un1B (B:)
    xetaafaalrkpvdvafgrnyvptwafdhikyfnggneiqlhldkytgtgfqskgsylfg
    hfsmqmklvpgdsagtvtafylssqnsehdeidfeflgnrtgqpyilqtnvftggkgdre
    qriylwfdptkefhyysvlwnmymivflvddvpirvfknckdlgvkfpfnqpmkiysslw
    naddwatrgglektdwskapfiasyrsfhidgceasveakfcatqgarwwdqkefqdlda
    fqyrrlswvrqkytiynyctdrsrypsmppeckrdrdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1un1B (B:)
    vafgrnyvptwafdhikyfnggneiqlhldkytgtgfqskgsylfghfsmqmklvpgdsa
    gtvtafylssqnsehdeidfeflgnrtgqpyilqtnvftggkgdreqriylwfdptkefh
    yysvlwnmymivflvddvpirvfknckdlgvkfpfnqpmkiysslwnaddwatrgglekt
    dwskapfiasyrsfhidgceasveakfcatqgarwwdqkefqdldafqyrrlswvrqkyt
    iynyctdrsrypsmppeckrdrdi