PDB entry 1un0

View 1un0 on RCSB PDB site
Description: crystal structure of yeast karyopherin (importin) alpha in complex with a nup2p n-terminal fragment
Class: nuclear import
Keywords: nuclear import, armadillo repeat, nucleoporin, nls release, karyopherin recycling
Deposited on 2003-09-03, released 2003-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.21781
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: importin alpha subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02821 (0-End)
      • engineered mutation (309)
    Domains in SCOPe 2.08: d1un0a_
  • Chain 'B':
    Compound: importin alpha subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02821 (0-End)
      • engineered mutation (309)
    Domains in SCOPe 2.08: d1un0b_
  • Chain 'C':
    Compound: nucleoporin nup2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: nucleoporin nup2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1un0A (A:)
    elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
    qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
    rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
    smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
    tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
    lvkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
    tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
    yfgeeedavdetmapqnagntfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1un0A (A:)
    elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
    qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
    rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
    smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
    tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
    lvkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
    tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
    yfgeeedavdetmapqnagn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1un0B (B:)
    elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
    qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
    rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
    smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
    tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
    lvkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
    tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
    yfgeeedavdetmapqnagntfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1un0B (B:)
    elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
    qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
    rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
    smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
    tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
    lvkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
    tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
    yfgeeedavdetmapqnag
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.