PDB entry 1umz

View 1umz on RCSB PDB site
Description: xyloglucan endotransglycosylase in complex with the xyloglucan nonasaccharide xllg.
Class: transferase
Keywords: glycoside hydrolase, xet, xth, xeh, transglycosylation, xyloglucan, transferase, glycosyltransferase
Deposited on 2003-09-03, released 2004-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xyloglucan endotransglycosylase
    Species: POPULUS TREMULA [TaxId:113636]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UMZ
    • Uniprot Q8GZD5 (Start-277)
    Domains in SCOPe 2.07: d1umza_
  • Chain 'B':
    Compound: xyloglucan endotransglycosylase
    Species: POPULUS TREMULA [TaxId:113636]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UMZ
    • Uniprot Q8GZD5 (Start-277)
    Domains in SCOPe 2.07: d1umzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1umzA (A:)
    xetaafaalrkpvdvafgrnyvptwafdhikyfnggneiqlhldkytgtgfqskgsylfg
    hfsmqmklvpgdsagtvtafylssqnsehdeidfeflgnrtgqpyilqtnvftggkgdre
    qriylwfdptkefhyysvlwnmymivflvddvpirvfknckdlgvkfpfnqpmkiysslw
    naddwatrgglektdwskapfiasyrsfhidgceasveakfcatqgarwwdqkefqdlda
    fqyrrlswvrqkytiynyctdrsrypsmppeckrdrdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umzA (A:)
    pvdvafgrnyvptwafdhikyfnggneiqlhldkytgtgfqskgsylfghfsmqmklvpg
    dsagtvtafylssqnsehdeidfeflgnrtgqpyilqtnvftggkgdreqriylwfdptk
    efhyysvlwnmymivflvddvpirvfknckdlgvkfpfnqpmkiysslwnaddwatrggl
    ektdwskapfiasyrsfhidgceasveakfcatqgarwwdqkefqdldafqyrrlswvrq
    kytiynyctdrsrypsmppeckrdrdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1umzB (B:)
    xetaafaalrkpvdvafgrnyvptwafdhikyfnggneiqlhldkytgtgfqskgsylfg
    hfsmqmklvpgdsagtvtafylssqnsehdeidfeflgnrtgqpyilqtnvftggkgdre
    qriylwfdptkefhyysvlwnmymivflvddvpirvfknckdlgvkfpfnqpmkiysslw
    naddwatrgglektdwskapfiasyrsfhidgceasveakfcatqgarwwdqkefqdlda
    fqyrrlswvrqkytiynyctdrsrypsmppeckrdrdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umzB (B:)
    vafgrnyvptwafdhikyfnggneiqlhldkytgtgfqskgsylfghfsmqmklvpgdsa
    gtvtafylssqnsehdeidfeflgnrtgqpyilqtnvftggkgdreqriylwfdptkefh
    yysvlwnmymivflvddvpirvfknckdlgvkfpfnqpmkiysslwnaddwatrgglekt
    dwskapfiasyrsfhidgceasveakfcatqgarwwdqkefqdldafqyrrlswvrqkyt
    iynyctdrsrypsmppeckrdrdi