PDB entry 1umy

View 1umy on RCSB PDB site
Description: bhmt from rat liver
Class: transferase
Keywords: transferase, methionine synthesis, homocysteine metabolism, betaine, methyltransferase, zinc
Deposited on 2003-09-02, released 2004-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.253
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: betaine--homocysteine s-methyltransferase
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O09171
      • conflict (246-247)
    Domains in SCOPe 2.07: d1umya_
  • Chain 'B':
    Compound: betaine--homocysteine s-methyltransferase
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O09171
      • conflict (246-247)
    Domains in SCOPe 2.07: d1umyb_
  • Chain 'C':
    Compound: betaine--homocysteine s-methyltransferase
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O09171
      • conflict (246-247)
    Domains in SCOPe 2.07: d1umyc_
  • Chain 'D':
    Compound: betaine--homocysteine s-methyltransferase
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O09171
      • conflict (246-247)
    Domains in SCOPe 2.07: d1umyd_
  • Heterogens: ZN, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1umyA (A:)
    mapiagkkakrgilerlnagevvigdggfvfalekrgyvkagpwtpeaavehpeavrqlh
    reflragsnvmqtftfyasedklenrgnyvaekisgqkvneaacdiarqvadegdalvag
    gvsqtpsylscksetevkkifhqqlevfmkknvdfliaeyfehveeavwavealktsgkp
    iaatmcigpegdlhgvspgecavrlvkagaaivgvnchfdpstslqtiklmkegleaarl
    kaylmsqplayhtpdcgkqgfidlpefpfgleprvatrwdiqkyareaynlgvryiggcc
    gfepyhiraiaeelapergflppasekhgswgsgldmhtkpwirararkeywqnlriasg
    rpynpsmskpdawgvtkgaaelmqqkeatteqqlralfekqkfksaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umyA (A:)
    krgilerlnagevvigdggfvfalekrgyvkagpwtpeaavehpeavrqlhreflragsn
    vmqtftfyassgqkvneaacdiarqvadegdalvaggvsqtpsylscksetevkkifhqq
    levfmkknvdfliaeyfehveeavwavealktsgkpiaatmcigpegdlhgvspgecavr
    lvkagaaivgvnchfdpstslqtiklmkegleaarlkaylmsqplayhtpdcgkqgfidl
    pefpfgleprvatrwdiqkyareaynlgvryiggccgfepyhiraiaeelapergflppa
    sekhgswgsgldmhtkpwirararkeywqnlriasgrpynpsmskpdawgvtkgaaelmq
    qkeatteqqlralfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1umyB (B:)
    mapiagkkakrgilerlnagevvigdggfvfalekrgyvkagpwtpeaavehpeavrqlh
    reflragsnvmqtftfyasedklenrgnyvaekisgqkvneaacdiarqvadegdalvag
    gvsqtpsylscksetevkkifhqqlevfmkknvdfliaeyfehveeavwavealktsgkp
    iaatmcigpegdlhgvspgecavrlvkagaaivgvnchfdpstslqtiklmkegleaarl
    kaylmsqplayhtpdcgkqgfidlpefpfgleprvatrwdiqkyareaynlgvryiggcc
    gfepyhiraiaeelapergflppasekhgswgsgldmhtkpwirararkeywqnlriasg
    rpynpsmskpdawgvtkgaaelmqqkeatteqqlralfekqkfksaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umyB (B:)
    krgilerlnagevvigdggfvfalekrgyvkagpwtpeaavehpeavrqlhreflragsn
    vmqtftfyasedaekisgqkvneaacdiarqvadegdalvaggvsqtpsylscksetevk
    kifhqqlevfmkknvdfliaeyfehveeavwavealktsgkpiaatmcigpegdlhgvsp
    gecavrlvkagaaivgvnchfdpstslqtiklmkegleaarlkaylmsqplayhtpdcgk
    qgfidlpefpfgleprvatrwdiqkyareaynlgvryiggccgfepyhiraiaeelaper
    gflppasekhgswgsgldmhtkpwirararkeywqnlriasgrpynpsmskpdawgvtkg
    aaelmqqkeatteqqlralfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1umyC (C:)
    mapiagkkakrgilerlnagevvigdggfvfalekrgyvkagpwtpeaavehpeavrqlh
    reflragsnvmqtftfyasedklenrgnyvaekisgqkvneaacdiarqvadegdalvag
    gvsqtpsylscksetevkkifhqqlevfmkknvdfliaeyfehveeavwavealktsgkp
    iaatmcigpegdlhgvspgecavrlvkagaaivgvnchfdpstslqtiklmkegleaarl
    kaylmsqplayhtpdcgkqgfidlpefpfgleprvatrwdiqkyareaynlgvryiggcc
    gfepyhiraiaeelapergflppasekhgswgsgldmhtkpwirararkeywqnlriasg
    rpynpsmskpdawgvtkgaaelmqqkeatteqqlralfekqkfksaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umyC (C:)
    krgilerlnagevvigdggfvfalekrgyvkagpwtpeaavehpeavrqlhreflragsn
    vmqtftfyasgqkvneaacdiarqvadegdalvaggvsqtpsylscksetevkkifhqql
    evfmkknvdfliaeyfehveeavwavealktsgkpiaatmcigpegdlhgvspgecavrl
    vkagaaivgvnchfdpstslqtiklmkegleaarlkaylmsqplayhtpdcgkqgfidlp
    efpfgleprvatrwdiqkyareaynlgvryiggccgfepyhiraiaeelapergflppas
    ekhgswgsgldmhtkpwirararkeywqnlriasgrpynpsmskpdawgvtkgaaelmqq
    keatteqqlralfekqkfksa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1umyD (D:)
    mapiagkkakrgilerlnagevvigdggfvfalekrgyvkagpwtpeaavehpeavrqlh
    reflragsnvmqtftfyasedklenrgnyvaekisgqkvneaacdiarqvadegdalvag
    gvsqtpsylscksetevkkifhqqlevfmkknvdfliaeyfehveeavwavealktsgkp
    iaatmcigpegdlhgvspgecavrlvkagaaivgvnchfdpstslqtiklmkegleaarl
    kaylmsqplayhtpdcgkqgfidlpefpfgleprvatrwdiqkyareaynlgvryiggcc
    gfepyhiraiaeelapergflppasekhgswgsgldmhtkpwirararkeywqnlriasg
    rpynpsmskpdawgvtkgaaelmqqkeatteqqlralfekqkfksaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umyD (D:)
    krgilerlnagevvigdggfvfalekrgyvkagpwtpeaavehpeavrqlhreflragsn
    vmqtftfyakisgqkvneaacdiarqvadegdalvaggvsqtpsylscksetevkkifhq
    qlevfmkknvdfliaeyfehveeavwavealktsgkpiaatmcigpegdlhgvspgecav
    rlvkagaaivgvnchfdpstslqtiklmkegleaarlkaylmsqplayhtpdcgkqgfid
    lpefpfgleprvatrwdiqkyareaynlgvryiggccgfepyhiraiaeelapergflpp
    asekhgswgsgldmhtkpwirararkeywqnlriasgrpynpsmskpdawgvtkgaaelm
    qqkeatteqqlralfekqkfks