PDB entry 1umv

View 1umv on RCSB PDB site
Description: crystal structure of an acidic, non-myotoxic phospholipase a2 from the venom of bothrops jararacussu
Deposited on 2003-08-28, released 2003-09-18
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-18, with a file datestamp of 2003-09-18.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.16413
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Domains in SCOP 1.67: d1umvx_

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1umvX (X:)
  slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcnpk
  idsytyskkngdvvcggdnpckkqicecdrvattcfrdnkdtydikywfygakncqekse
  pc