PDB entry 1umv

View 1umv on RCSB PDB site
Description: crystal structure of an acidic, non-myotoxic phospholipase a2 from the venom of bothrops jararacussu
Class: lipase
Keywords: acidic, non-myotoxic, pla2, bothrops jararacussu, lipase
Deposited on 2003-08-28, released 2003-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.164
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: hypotensive phospholipase A2
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AXY1 (0-121)
      • conflict (57)
      • conflict (78)
    Domains in SCOPe 2.08: d1umvx_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1umvX (X:)
    slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcnpk
    idsytyskkngdvvcggdnpckkqicecdrvattcfrdnkdtydikywfygakncqekse
    pc