PDB entry 1umu

View 1umu on RCSB PDB site
Description: structure determination of umud' by mad phasing of the selenomethionyl protein
Class: sos mutagenesis
Keywords: induced mutagenesis, sos mutagenesis, DNA repair, beta-lactamase cleavage reaction, lexa repressor, lambda ci
Deposited on 1996-03-07, released 1996-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: umud'
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04153
      • conflict (36)
      • conflict (85)
    Domains in SCOPe 2.07: d1umua_
  • Chain 'B':
    Compound: umud'
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04153
      • conflict (36)
      • conflict (85)
      • insertion (112)
    Domains in SCOPe 2.07: d1umub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1umuA (A:)
    gfpspaadyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgd
    iviaavdgeftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvkaatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umuA (A:)
    dyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgdiviaavd
    geftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1umuB (B:)
    gfpspaadyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgd
    iviaavdgeftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvkaatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umuB (B:)
    dyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgdiviaavd
    geftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvka