PDB entry 1umr

View 1umr on RCSB PDB site
Description: Crystal structure of the platelet activator convulxin, a disulfide linked a4b4 cyclic tetramer from the venom of Crotalus durissus terrificus
Class: sugar-binding protein
Keywords: lectin, c-type lectin, platelet, sugar-binding protein, activator, snake venom
Deposited on 2003-08-28, released 2003-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: convulxin alpha
    Species: CROTALUS DURISSUS TERRIFICUS [TaxId:8732]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1umra_
  • Chain 'B':
    Compound: convulxin alpha
    Species: CROTALUS DURISSUS TERRIFICUS [TaxId:8732]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1umrb_
  • Chain 'C':
    Compound: convulxin beta
    Species: CROTALUS DURISSUS TERRIFICUS [TaxId:8732]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1umrc_
  • Chain 'D':
    Compound: convulxin beta
    Species: CROTALUS DURISSUS TERRIFICUS [TaxId:8732]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1umrd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1umrA (A:)
    glhcpsdwyyydqhcyrifneemnwedaewfctkqakgahlvsiksakeadfvawmvtqn
    ieesfshvsiglrvqnkekqcstkwsdgssvsydnlldlyitkcsllkketgfrkwfvas
    cigkipfvckfppqc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1umrB (B:)
    glhcpsdwyyydqhcyrifneemnwedaewfctkqakgahlvsiksakeadfvawmvtqn
    ieesfshvsiglrvqnkekqcstkwsdgssvsydnlldlyitkcsllkketgfrkwfvas
    cigkipfvckfppqc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1umrC (C:)
    gfccpshwssydrycykvfkqemtwadaekfctqqhtgshlvsfhsteevdfvvkmthqs
    lkstffwiganniwnkcnwqwsdgtkpeykewheefeclisrtfdnqwlsapcsdtysfv
    ckfea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1umrD (D:)
    gfccpshwssydrycykvfkqemtwadaekfctqqhtgshlvsfhsteevdfvvkmthqs
    lkstffwiganniwnkcnwqwsdgtkpeykewheefeclisrtfdnqwlsapcsdtysfv
    ckfea