PDB entry 1umn

View 1umn on RCSB PDB site
Description: crystal structure of dps-like peroxide resistance protein (dpr) from streptococcus suis
Class: peroxide resistance
Keywords: peroxide resistance, iron-binding, ferroxidase, dps-family, ferritin-like
Deposited on 2003-08-26, released 2004-04-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.185
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1umna_
  • Chain 'B':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1umnb_
  • Chain 'C':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1umnc_
  • Chain 'D':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1umnd_
  • Chain 'E':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1umne_
  • Chain 'F':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1umnf_
  • Chain 'G':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1umng_
  • Chain 'H':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1umnh_
  • Chain 'I':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1umni_
  • Chain 'J':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1umnj_
  • Chain 'K':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1umnk_
  • Chain 'L':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1umnl_
  • Heterogens: CA, CL, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1umnA (A:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umnA (A:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1umnB (B:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umnB (B:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1umnC (C:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umnC (C:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1umnD (D:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umnD (D:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1umnE (E:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umnE (E:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1umnF (F:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umnF (F:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1umnG (G:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1umnH (H:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umnH (H:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1umnI (I:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umnI (I:)
    psladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemser
    litlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdee
    gdsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1umnJ (J:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umnJ (J:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1umnK (K:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umnK (K:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1umnL (L:)
    qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umnL (L:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl