PDB entry 1uml

View 1uml on RCSB PDB site
Description: crystal structure of adenosine deaminase complexed with a potent inhibitor fr233624
Deposited on 2003-10-03, released 2004-09-21
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1umla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1umlA (A:)
    aqtpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdf
    lakfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqae
    gdltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaid
    lagdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyh
    tledttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifk
    stldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmpspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umlA (A:)
    tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla
    kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
    ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
    gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
    edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr