PDB entry 1umj

View 1umj on RCSB PDB site
Description: Crystal structure of Pyrococcus horikoshii CutA in the presence of 3M guanidine hydrochloride
Class: structural genomics, unknown function
Keywords: cuta, copper tolerance, structural genomics, unknown function
Deposited on 2003-10-02, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.214
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic divalent cation tolerance protein cutA
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0992
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1umja_
  • Chain 'B':
    Compound: Periplasmic divalent cation tolerance protein cutA
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0992
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1umjb_
  • Heterogens: GAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1umjA (A:)
    miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
    lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umjA (A:)
    miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
    lweelkerikelhpydvpaiiridvddvnedylkwlieetk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1umjB (B:)
    miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
    lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umjB (B:)
    miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
    lweelkerikelhpydvpaiiridvddvnedylkwlieetk