PDB entry 1umi

View 1umi on RCSB PDB site
Description: Structural basis of sugar-recognizing ubiquitin ligase
Class: ligase
Keywords: ubiquitin, scf, ubiquitin ligase, lectin, ligase
Deposited on 2003-10-01, released 2004-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F-box only protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: MOUSE
    Database cross-references and differences (RAF-indexed):
    • GB AAH46586 (3-183)
      • cloning artifact (0-2)
      • engineered (18)
      • see remark 999 (37)
    Domains in SCOPe 2.08: d1umia1, d1umia2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1umiA (A:)
gshfyflskrrrnllrnpageedlegwsdvehggdgwkveelpgdngveftqddsvkkyf
assfewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsened
vlaefatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssv
wvep