PDB entry 1umh

View 1umh on RCSB PDB site
Description: Structural basis of sugar-recognizing ubiquitin ligase
Class: ligase
Keywords: UBIQUITIN, SCF, UBIQUITIN LIGASE, LECTIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2003-10-01, released 2004-04-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.155
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F-box only protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: MOUSE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q80UW2 (3-183)
      • cloning artifact (0-2)
      • see remark 999 (37)
    Domains in SCOPe 2.05: d1umha_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1umhA (A:)
    gshfyflskrrrnllrnpcgeedlegwsdvehggdgwkveelpgdngveftqddsvkkyf
    assfewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsened
    vlaefatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssv
    wvep