PDB entry 1umf

View 1umf on RCSB PDB site
Description: crystal structure of chorismate synthase
Class: lyase
Keywords: beta-alpha-beta sandwich fold, lyase
Deposited on 2003-09-30, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.202
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chorismate synthase
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1umfa_
  • Chain 'B':
    Compound: Chorismate synthase
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1umfb_
  • Chain 'C':
    Compound: Chorismate synthase
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1umfc_
  • Chain 'D':
    Compound: Chorismate synthase
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1umfd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1umfA (A:)
    mntlgrflrlttfgeshgdviggvldgmpsgikidyallenemkrrqggrnvfitprked
    dkveitsgvfedfstgtpigflihnqrarskdydniknlfrpshadftyfhkygirdfrg
    ggrssaresairvaagafakmllreigivcesgiieiggikaknydfnhalkseifalde
    eqeeaqktaiqnaiknhdsiggvalirarsiktnqklpiglgqglyakldakiaeammgl
    ngvkaveigkgvessllkgseyndlmdqkgflsnrsggvlggmsngeeiivrvhfkptps
    ifqpqrtidingnececllkgrhdpciairgsvvcesllalvladmvllnltskieylkt
    iynen
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1umfB (B:)
    mntlgrflrlttfgeshgdviggvldgmpsgikidyallenemkrrqggrnvfitprked
    dkveitsgvfedfstgtpigflihnqrarskdydniknlfrpshadftyfhkygirdfrg
    ggrssaresairvaagafakmllreigivcesgiieiggikaknydfnhalkseifalde
    eqeeaqktaiqnaiknhdsiggvalirarsiktnqklpiglgqglyakldakiaeammgl
    ngvkaveigkgvessllkgseyndlmdqkgflsnrsggvlggmsngeeiivrvhfkptps
    ifqpqrtidingnececllkgrhdpciairgsvvcesllalvladmvllnltskieylkt
    iynen
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1umfC (C:)
    mntlgrflrlttfgeshgdviggvldgmpsgikidyallenemkrrqggrnvfitprked
    dkveitsgvfedfstgtpigflihnqrarskdydniknlfrpshadftyfhkygirdfrg
    ggrssaresairvaagafakmllreigivcesgiieiggikaknydfnhalkseifalde
    eqeeaqktaiqnaiknhdsiggvalirarsiktnqklpiglgqglyakldakiaeammgl
    ngvkaveigkgvessllkgseyndlmdqkgflsnrsggvlggmsngeeiivrvhfkptps
    ifqpqrtidingnececllkgrhdpciairgsvvcesllalvladmvllnltskieylkt
    iynen
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1umfD (D:)
    mntlgrflrlttfgeshgdviggvldgmpsgikidyallenemkrrqggrnvfitprked
    dkveitsgvfedfstgtpigflihnqrarskdydniknlfrpshadftyfhkygirdfrg
    ggrssaresairvaagafakmllreigivcesgiieiggikaknydfnhalkseifalde
    eqeeaqktaiqnaiknhdsiggvalirarsiktnqklpiglgqglyakldakiaeammgl
    ngvkaveigkgvessllkgseyndlmdqkgflsnrsggvlggmsngeeiivrvhfkptps
    ifqpqrtidingnececllkgrhdpciairgsvvcesllalvladmvllnltskieylkt
    iynen