PDB entry 1umd

View 1umd on RCSB PDB site
Description: branched-chain 2-oxo acid dehydrogenase (E1) from Thermus thermophilus HB8 with 4-methyl-2-oxopentanoate as an intermediate
Class: Oxidoreductase
Keywords: alpha(2)beta(2) tetramer, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Oxidoreductase
Deposited on 2003-09-25, released 2004-03-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.172
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-oxo acid dehydrogenase alpha subunit
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1umda_
  • Chain 'B':
    Compound: 2-oxo acid dehydrogenase beta subunit
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1umdb1, d1umdb2
  • Chain 'C':
    Compound: 2-oxo acid dehydrogenase alpha subunit
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1umdc_
  • Chain 'D':
    Compound: 2-oxo acid dehydrogenase beta subunit
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1umdd1, d1umdd2
  • Heterogens: MG, TDP, COI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1umdA (A:)
    mvkethrfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilir
    tgktsfiapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatka
    dpnkgrqmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatse
    gdwyaginfaavqgapavfiaennfyaisvdyrhqthsptiadkahafgipgylvdgmdv
    lasyyvvkeaverarrgegpslvelrvyrygphssadddsryrpkeevafwrkkdpiprf
    rrflearglwneeweedvreeiraelerglkeaeeagpvppewmfedvfaekpwhllrqe
    allkeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umdA (A:)
    hrfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilirtgkts
    fiapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatkadpnkg
    rqmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatsegdwya
    ginfaavqgapavfiaennfyaisvdyrhqthsptiadkahafgipgylvdgmdvlasyy
    vvkeaverarrgegpslvelrvyrygphssadddsryrpkeevafwrkkdpiprfrrfle
    arglwneeweedvreeiraelerglkeaeeagpvppewmfedvfaekpwhllrqeallke
    el
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1umdB (B:)
    malmtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplse
    aaivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsg
    ggvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsv
    keevpeedytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlm
    pwdyeavmnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpyp
    yaqdklylptvtrilnaakraldy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umdB (B:)
    almtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplsea
    aivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsgg
    gvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsvk
    eevpeedytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlmp
    wdyeavmnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpypy
    aqdklylptvtrilnaakraldy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1umdC (C:)
    mvkethrfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilir
    tgktsfiapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatka
    dpnkgrqmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatse
    gdwyaginfaavqgapavfiaennfyaisvdyrhqthsptiadkahafgipgylvdgmdv
    lasyyvvkeaverarrgegpslvelrvyrygphssadddsryrpkeevafwrkkdpiprf
    rrflearglwneeweedvreeiraelerglkeaeeagpvppewmfedvfaekpwhllrqe
    allkeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umdC (C:)
    hrfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilirtgkts
    fiapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatkadpnkg
    rqmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatsegdwya
    ginfaavqgapavfiaennfyaisvdyrhqthsptiadkahafgipgylvdgmdvlasyy
    vvkeaverarrgegpslvelrvyrygphssadddsryrpkeevafwrkkdpiprfrrfle
    arglwneeweedvreeiraelerglkeaeeagpvppewmfedvfaekpwhllrqeallke
    e
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1umdD (D:)
    malmtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplse
    aaivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsg
    ggvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsv
    keevpeedytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlm
    pwdyeavmnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpyp
    yaqdklylptvtrilnaakraldy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umdD (D:)
    almtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplsea
    aivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsgg
    gvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsvk
    eevpeedytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlmp
    wdyeavmnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpypy
    aqdklylptvtrilnaakraldy