PDB entry 1umb

View 1umb on RCSB PDB site
Description: branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form
Deposited on 2003-09-25, released 2004-03-30
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.169
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1umbA (A:)
    mvkethrfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilir
    tgktsfiapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatka
    dpnkgrqmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatse
    gdwyaginfaavqgapavfiaennfyaisvdyrhqthsptiadkahafgipgylvdgmdv
    lasyyvvkeaverarrgegpslvelrvyrygphssadddsryrpkeevafwrkkdpiprf
    rrflearglwneeweedvreeiraelerglkeaeeagpvppewmfedvfaekpwhllrqe
    allkeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umbA (A:)
    hrfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilirtgkts
    fiapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatkadpnkg
    rqmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatsegdwya
    ginfaavqgapavfiaennfyaisvdyrhqthsptiadkahafgipgylvdgmdvlasyy
    vvkeaverarrgegpslvelrvyrygphssadddsryrpkeevafwrkkdpiprfrrfle
    arglwneeweedvreeiraelerglkeaeeagpvppewmfedvfaekpwhllrqeallke
    el
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1umbB (B:)
    malmtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplse
    aaivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsg
    ggvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsv
    keevpeedytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlm
    pwdyeavmnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpyp
    yaqdklylptvtrilnaakraldy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umbB (B:)
    almtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplsea
    aivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsgg
    gvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsvk
    eevpeedytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlmp
    wdyeavmnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpypy
    aqdklylptvtrilnaakraldy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1umbC (C:)
    mvkethrfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilir
    tgktsfiapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatka
    dpnkgrqmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatse
    gdwyaginfaavqgapavfiaennfyaisvdyrhqthsptiadkahafgipgylvdgmdv
    lasyyvvkeaverarrgegpslvelrvyrygphssadddsryrpkeevafwrkkdpiprf
    rrflearglwneeweedvreeiraelerglkeaeeagpvppewmfedvfaekpwhllrqe
    allkeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umbC (C:)
    hrfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilirtgkts
    fiapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatkadpnkg
    rqmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatsegdwya
    ginfaavqgapavfiaennfyaisvdyrhqthsptiadkahafgipgylvdgmdvlasyy
    vvkeaverarrgegpslvelrvyrygphssadddsryrpkeevafwrkkdpiprfrrfle
    arglwneeweedvreeiraelerglkeaeeagpvppewmfedvfaekpwhllrqeallke
    e
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1umbD (D:)
    malmtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplse
    aaivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsg
    ggvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsv
    keevpeedytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlm
    pwdyeavmnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpyp
    yaqdklylptvtrilnaakraldy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umbD (D:)
    almtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplsea
    aivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsgg
    gvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsvk
    eevpeedytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlmp
    wdyeavmnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpypy
    aqdklylptvtrilnaakraldy