PDB entry 1um8

View 1um8 on RCSB PDB site
Description: Crystal structure of helicobacter pylori ClpX
Class: Chaperone
Keywords: ClpP binding loop, Chaperone
Deposited on 2003-09-25, released 2003-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.219
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease ATP-binding subunit clpX
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: Clpx
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1um8a_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1um8A (A:)
    eeefllsyipapkelkavldnyvigqeqakkvfsvavynhykrlsfkeklkkqdnqdsnv
    elehleevelsksnilligptgsgktlmaqtlakhldipiaisdatslteagyvgedven
    iltrllqasdwnvqkaqkgivfideidkisrlsenrsitrdvsgegvqqallkivegslv
    nippkggrkhpegnfiqidtsdilficagafdglaeiikkrttqnvlgftqekmskkeqe
    ailhlvqthdlvtyglipeligrlpvlstldsisleamvdilqkpknalikqyqqlfkmd
    evdlifeeeaikeiaqlalerktgarglraiiedfcldimfdlpklkgsevritkdcvlk
    qaepliiakthskilp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1um8A (A:)
    llsyipapkelkavldnyvigqeqakkvfsvavynhykrlsfkeklkkqdnqdsnveleh
    leevelsksnilligptgsgktlmaqtlakhldipiaisdatsltveniltrllqasdwn
    vqkaqkgivfideidkigegvqqallkivegslvnqidtsdilficagafdglaeiikkr
    ttqnvlgftqekmskkeqeailhlvqthdlvtyglipeligrlpvlstldsisleamvdi
    lqkpknalikqyqqlfkmdevdlifeeeaikeiaqlalerktgarglraiiedfcldimf
    dlpklkgsevritkdcvlkqaepliia