PDB entry 1um4

View 1um4 on RCSB PDB site
Description: Catalytic Antibody 21H3 with hapten
Deposited on 2003-09-23, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.223
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1um4H (H:)
    vqlqqsgpvlvkpggsvkmsckaseytltsylfqwvkqksgqglewigyiypynggtryn
    ekfrgkatltsdkssntaylelssltsedsavyycarssmsdpganwgpgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1um4L (L:)
    ldiqmtqspsslsaslgervsltcrasqeisgylywlqqkpdgtikrliyagstldsgvp
    krfsgsrsgsdysltisslesedfadyyclqyasyprtfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgecgaga