PDB entry 1um3

View 1um3 on RCSB PDB site
Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus
Class: photosynthesis
Keywords: photosynthesis, membrane protein complex, electron transfer complex
Deposited on 2003-09-22, released 2003-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2004-04-20, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.258
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b6
    Species: Mastigocladus laminosus
    Gene:
    Domains in SCOPe 2.06: d1um3a_
  • Chain 'B':
    Compound: subunit IV
    Species: Mastigocladus laminosus
    Gene:
    Domains in SCOPe 2.06: d1um3b_
  • Chain 'C':
    Compound: cytochrome f
    Species: Mastigocladus laminosus
    Gene:
  • Chain 'D':
    Compound: Rieske iron-sulfur protein
    Species: Mastigocladus laminosus
    Gene:
    Domains in SCOPe 2.06: d1um3d1, d1um3d2
  • Chain 'E':
    Compound: protein pet l
    Species: Mastigocladus laminosus
    Gene:
  • Chain 'F':
    Compound: protein pet m
    Species: Mastigocladus laminosus
    Gene:
    Domains in SCOPe 2.06: d1um3f_
  • Chain 'G':
    Compound: protein pet g
    Species: Mastigocladus laminosus
    Gene:
  • Chain 'H':
    Compound: protein pet n
    Species: Mastigocladus laminosus
    Gene:
    Domains in SCOPe 2.06: d1um3h_
  • Chain 'N':
    Compound: Cytochrome b6
    Species: Mastigocladus laminosus
    Gene:
    Domains in SCOPe 2.06: d1um3n_
  • Chain 'O':
    Compound: subunit IV
    Species: Mastigocladus laminosus
    Gene:
    Domains in SCOPe 2.06: d1um3o_
  • Chain 'P':
    Compound: cytochrome f
    Species: Mastigocladus laminosus
    Gene:
  • Chain 'Q':
    Compound: Rieske iron-sulfur protein
    Species: Mastigocladus laminosus
    Gene:
    Domains in SCOPe 2.06: d1um3q1, d1um3q2
  • Chain 'R':
    Compound: protein pet l
    Species: Mastigocladus laminosus
    Gene:
  • Chain 'S':
    Compound: protein pet m
    Species: Mastigocladus laminosus
    Gene:
    Domains in SCOPe 2.06: d1um3s_
  • Chain 'T':
    Compound: protein pet g
    Species: Mastigocladus laminosus
    Gene:
    Domains in SCOPe 2.06: d1um3t_
  • Chain 'U':
    Compound: protein pet n
    Species: Mastigocladus laminosus
    Gene:
    Domains in SCOPe 2.06: d1um3u_
  • Heterogens: HEM, TDS, PL9, OPC, CLA, FES, BCR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1um3A (A:)
    manvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykp
    tvteayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwis
    gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
    tryysahtfvlpwliavfmllhflmirkqgisgpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1um3A (A:)
    eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
    mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
    vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
    wliavfmllhflmirkqgisgp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1um3B (B:)
    matlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpa
    mvgepanpfatpleilpewylypvfqilrslpnkllgvllmasvplglilvpfienvnkf
    qnpfrrpvattiflfgtlvtiwlgigaalpldktltlglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1um3B (B:)
    lakgmghnyygepawpndllyvfpvvimgtfacivalsvldpamvgepanpfatpleilp
    ewylypvfqilrslpnkllgvllmasvplglilvpfienvnkfqnpfrrpvattiflfgt
    lvtiwlgigaalpldktl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1um3D (D:)
    maqftesmdvpdmgrrqfmnllafgtvtgvalgalyplvkyfippsggavgggttakdkl
    gnnvkvskfleshnagdrvlvqglkgdptyivveskeairdyginavcthlgcvvpwnaa
    enkfkcpchgsqydetgrvirgpaplslalchatvqddnivltpwtetdfrtgekpwwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1um3D (D:)
    dmgrrqfmnllafgtvtgvalgalyplvkyfippsggavgggttakdklgnnvkvskfle
    shnagdrvlvqglkgdptyivveskeairdyginavcthlgcvvpwnaaenkfkcpchgs
    qydetgrvirgpaplslalchatvqddnivltpwtetdfrtgekpwwv
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1um3F (F:)
    mteemlyaallsfglifvgwglgvlllkiqgaeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1um3F (F:)
    mteemlyaallsfglifvgwglgvlllkiqgae
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1um3H (H:)
    meidvlgwvallvvftwsiamvvwgrngl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1um3H (H:)
    idvlgwvallvvftwsiamvvwgrngl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1um3N (N:)
    manvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykp
    tvteayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwis
    gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
    tryysahtfvlpwliavfmllhflmirkqgisgpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1um3N (N:)
    eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
    mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
    vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
    wliavfmllhflmirkqgisgp
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1um3O (O:)
    matlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpa
    mvgepanpfatpleilpewylypvfqilrslpnkllgvllmasvplglilvpfienvnkf
    qnpfrrpvattiflfgtlvtiwlgigaalpldktltlglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1um3O (O:)
    lakgmghnyygepawpndllyvfpvvimgtfacivalsvldpamvgepanpfatpleilp
    ewylypvfqilrslpnkllgvllmasvplglilvpfienvnkfqnpfrrpvattiflfgt
    lvtiwlgigaalpldktl
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1um3Q (Q:)
    maqftesmdvpdmgrrqfmnllafgtvtgvalgalyplvkyfippsggavgggttakdkl
    gnnvkvskfleshnagdrvlvqglkgdptyivveskeairdyginavcthlgcvvpwnaa
    enkfkcpchgsqydetgrvirgpaplslalchatvqddnivltpwtetdfrtgekpwwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1um3Q (Q:)
    dmgrrqfmnllafgtvtgvalgalyplvkyfippsggavgggttakdklgnnvkvskfle
    shnagdrvlvqglkgdptyivveskeairdyginavcthlgcvvpwnaaenkfkcpchgs
    qydetgrvirgpaplslalchatvqddnivltpwtetdfrtgekpwwv
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1um3S (S:)
    mteemlyaallsfglifvgwglgvlllkiqgaeke
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1um3T (T:)
    mveplldglvlglvfatlgglfyaayqqykrpnelgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1um3T (T:)
    lvlglvfatlgglfyaayqqykrpnel
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1um3U (U:)
    meidvlgwvallvvftwsiamvvwgrngl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1um3U (U:)
    idvlgwvallvvftwsiamvvwgrngl