PDB entry 1um2

View 1um2 on RCSB PDB site
Description: crystal structure of the vma1-derived endonuclease with the ligated extein segment
Deposited on 2003-09-22, released 2004-09-22
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-22, with a file datestamp of 2004-09-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.214
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1um2A (A:)
    sfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnatnelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
    elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
    pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
    eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkdgv
    knipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslglv
    vsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarecrgfy
    felqelkeddyygitlsddsdhqfllanqvvvhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1um2A (A:)
    sfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqkspellkf
    tcnatnelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgrivelvkevsksypis
    egperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyapilyendhffdym
    qkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnlcaeyk
    drkepqvaktvnlyskenplwdaivglgflkdgvknipsflstdnigtretflaglidsd
    gyvtdehgikatiktihtsvrdglvslarslglvvsvnaepisyaiymsggdvllnvlsk
    cagskkfrpapaaafarecrgfyfelqelkeddyygitlsddsdhqfllanqvvvhn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1um2B (B:)
    sfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnatnelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
    elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
    pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
    eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkdgv
    knipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslglv
    vsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarecrgfy
    felqelkeddyygitlsddsdhqfllanqvvvhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1um2B (B:)
    sfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqkellkftc
    natnelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgrivelvkevsksypiseg
    peranelvesyrkasnkayfewtieardlsllgshvrkatyqtyapilyendhffdymqk
    skfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnlcaeykdr
    kepqvaktvnlyslntenplwdaivglgflkdgvknipsflstdnigtretflaglidsd
    gyvtdehgikatiktihtsvrdglvslarslglvvsvnaephkisyaiymsggdvllnvl
    skcagskkfrpapaaafarecrgfyfelqelkeddyygitlsddsdhqfllanqvvvhn