PDB entry 1um1

View 1um1 on RCSB PDB site
Description: Solution Structure of RSGI RUH-007, PDZ domain in Human cDNA
Class: structural genomics, unknown function
Keywords: PDZ domain, Human cDNA, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-09-22, released 2004-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1849 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA KIAA1849
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96JH8 (7-103)
      • cloning artifact (0-6)
      • cloning artifact (104-109)
    Domains in SCOPe 2.07: d1um1a1, d1um1a2, d1um1a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1um1A (A:)
    gssgssgyvftvelergpsglgmglidgmhthlgapglyiqtllpgspaaadgrlslgdr
    ilevngssllglgylravdlirhggkkmrflvaksdvetakkihsgpssg