PDB entry 1um0

View 1um0 on RCSB PDB site
Description: Crystal structure of chorismate synthase complexed with FMN
Class: lyase
Keywords: beta-alpha-beta sandwich fold, LYASE
Deposited on 2003-09-18, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.214
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chorismate synthase
    Species: Helicobacter pylori [TaxId:210]
    Gene: aroC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1um0a_
  • Chain 'B':
    Compound: Chorismate synthase
    Species: Helicobacter pylori [TaxId:210]
    Gene: aroC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1um0b_
  • Chain 'C':
    Compound: Chorismate synthase
    Species: Helicobacter pylori [TaxId:210]
    Gene: aroC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1um0c_
  • Chain 'D':
    Compound: Chorismate synthase
    Species: Helicobacter pylori [TaxId:210]
    Gene: aroC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1um0d_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1um0A (A:)
    mntlgrflrlttfgeshgdviggvldgmpsgikidyallenemkrrqggrnvfitprked
    dkveitsgvfedfstgtpigflihnqrarskdydniknlfrpshadftyfhkygirdfrg
    ggrssaresairvaagafakmllreigivcesgiieiggikaknydfnhalkseifalde
    eqeeaqktaiqnaiknhdsiggvalirarsiktnqklpiglgqglyakldakiaeammgl
    ngvkaveigkgvessllkgseyndlmdqkgflsnrsggvlggmsngeeiivrvhfkptps
    ifqpqrtidingnececllkgrhdpciairgsvvcesllalvladmvllnltskieylkt
    iynen
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1um0B (B:)
    mntlgrflrlttfgeshgdviggvldgmpsgikidyallenemkrrqggrnvfitprked
    dkveitsgvfedfstgtpigflihnqrarskdydniknlfrpshadftyfhkygirdfrg
    ggrssaresairvaagafakmllreigivcesgiieiggikaknydfnhalkseifalde
    eqeeaqktaiqnaiknhdsiggvalirarsiktnqklpiglgqglyakldakiaeammgl
    ngvkaveigkgvessllkgseyndlmdqkgflsnrsggvlggmsngeeiivrvhfkptps
    ifqpqrtidingnececllkgrhdpciairgsvvcesllalvladmvllnltskieylkt
    iynen
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1um0C (C:)
    mntlgrflrlttfgeshgdviggvldgmpsgikidyallenemkrrqggrnvfitprked
    dkveitsgvfedfstgtpigflihnqrarskdydniknlfrpshadftyfhkygirdfrg
    ggrssaresairvaagafakmllreigivcesgiieiggikaknydfnhalkseifalde
    eqeeaqktaiqnaiknhdsiggvalirarsiktnqklpiglgqglyakldakiaeammgl
    ngvkaveigkgvessllkgseyndlmdqkgflsnrsggvlggmsngeeiivrvhfkptps
    ifqpqrtidingnececllkgrhdpciairgsvvcesllalvladmvllnltskieylkt
    iynen
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1um0D (D:)
    mntlgrflrlttfgeshgdviggvldgmpsgikidyallenemkrrqggrnvfitprked
    dkveitsgvfedfstgtpigflihnqrarskdydniknlfrpshadftyfhkygirdfrg
    ggrssaresairvaagafakmllreigivcesgiieiggikaknydfnhalkseifalde
    eqeeaqktaiqnaiknhdsiggvalirarsiktnqklpiglgqglyakldakiaeammgl
    ngvkaveigkgvessllkgseyndlmdqkgflsnrsggvlggmsngeeiivrvhfkptps
    ifqpqrtidingnececllkgrhdpciairgsvvcesllalvladmvllnltskieylkt
    iynen