PDB entry 1ulz

View 1ulz on RCSB PDB site
Description: Crystal structure of the biotin carboxylase subunit of pyruvate carboxylase
Deposited on 2003-09-18, released 2004-03-09
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-09, with a file datestamp of 2004-03-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.199
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulzA (A:)
    mvnkvlvanrgeiavriirackelgiptvaiynevestarhvkladeaymigtdpldtyl
    nkqriinlalevgadaihpgygflaenaefakmceeagitfigphwkvielmgdkarske
    vmkkagvpvvpgsdgvlksleeakalareigypvllkataggggrgiricrneeelvkny
    eqasreaekafgrgdlllekfienpkhieyqvlgdkhgnvihlgerdcsiqrrnqklvei
    apsliltpekreyygnivtkaakeigyynagtmefiadqegnlyfiemntriqvehpvse
    mvtgidivkwqikiaagepltikqedvkfngyaiecrinaedpkknfapstrvieryyvp
    ggfgirvehaaargfevtpyydsmiaklitwaptwdeavermraaletyeitgvkttipl
    linimkekdfkagkfttkyleehpevfeyee