PDB entry 1ulz

View 1ulz on RCSB PDB site
Description: Crystal structure of the biotin carboxylase subunit of pyruvate carboxylase
Class: ligase
Keywords: Biotin Carboxylase, Pyruvate Carboxylase, Aquifex aeolicus, LIGASE
Deposited on 2003-09-18, released 2004-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate carboxylase n-terminal domain
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67483 (0-450)
      • engineered (1)
      • see remark 999 (351)
      • see remark 999 (404)
    Domains in SCOPe 2.07: d1ulza1, d1ulza2, d1ulza3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulzA (A:)
    mvnkvlvanrgeiavriirackelgiptvaiynevestarhvkladeaymigtdpldtyl
    nkqriinlalevgadaihpgygflaenaefakmceeagitfigphwkvielmgdkarske
    vmkkagvpvvpgsdgvlksleeakalareigypvllkataggggrgiricrneeelvkny
    eqasreaekafgrgdlllekfienpkhieyqvlgdkhgnvihlgerdcsiqrrnqklvei
    apsliltpekreyygnivtkaakeigyynagtmefiadqegnlyfiemntriqvehpvse
    mvtgidivkwqikiaagepltikqedvkfngyaiecrinaedpkknfapstrvieryyvp
    ggfgirvehaaargfevtpyydsmiaklitwaptwdeavermraaletyeitgvkttipl
    linimkekdfkagkfttkyleehpevfeyee