PDB entry 1uly

View 1uly on RCSB PDB site
Description: Crystal structure analysis of the ArsR homologue DNA-binding protein from P. horikoshii OT3
Class: DNA binding protein
Keywords: helix-turn-helix, structural genomics, DNA BINDING PROTEIN
Deposited on 2003-09-17, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH1932
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1932
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ulyA (A:)
    makkvkvitdpevikvmledtrrkilkllrnkemtisqlseilgktpqtiyhhieklkea
    glvevkrtemkgnlvekyygrtadvfyinlylgdeelryiarsrlktkidifkrlgyqfe
    enellnimdrmsqkefdatvriskyieekedalkdfsnediihaiewlstaelardeeyl
    ellkrlgsilkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulyA (A:)
    akkvkvitdpevikvmledtrrkilkllrnkemtisqlseilgktpqtiyhhieklkeag
    lvevkrtemkgnlvekyygrtadvfyinlylgdeelryiarsrlktkidifkrlgyqfee
    nellnimdrmsqkefdatvriskyieekedalkdfsnediihaiewlstaelardeeyle
    llkrlgsilk